PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.I00828.1.p
Common NameEUGRSUZ_I00828, LOC104420396
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 263aa    MW: 30036.1 Da    PI: 8.1477
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.I00828.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.55.6e-121966148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+W+++Ed +lv ++ ++G  +W+   +  g+ Rt+k+c++rw +yl
  Eucgr.I00828.1.p 19 KGAWSADEDRKLVAYIMRYGIWNWTHMVEPAGLARTGKSCRLRWMNYL 66
                      79******************99****999999**************97 PP

2Myb_DNA-binding54.92e-1773117248
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       g+ T+eE+e+++++++ lG++ W+tIa++++ gRt++++k++w+++l
  Eucgr.I00828.1.p  73 GNITKEEEEIIINLHRVLGKR-WATIASRLP-GRTDNEIKNYWNTHL 117
                       678******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.9661466IPR017930Myb domain
SuperFamilySSF466891.8E-2717113IPR009057Homeodomain-like
SMARTSM007172.3E-81868IPR001005SANT/Myb domain
PfamPF002492.4E-101966IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-212073IPR009057Homeodomain-like
CDDcd001673.03E-72166No hitNo description
PROSITE profilePS5129426.11467121IPR017930Myb domain
SMARTSM007178.1E-1771119IPR001005SANT/Myb domain
PfamPF002496.5E-1573117IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-2574120IPR009057Homeodomain-like
CDDcd001674.41E-785117No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MARYPRVDKI SNGKKTVKKG AWSADEDRKL VAYIMRYGIW NWTHMVEPAG LARTGKSCRL  60
RWMNYLRPNI KHGNITKEEE EIIINLHRVL GKRWATIASR LPGRTDNEIK NYWNTHLKKR  120
CAQEKLEMPI ACDVKVNSNP NNNLTHQNPS IAILHPTEAT NLGSPRDIPV LHASSLCPSH  180
EVVHDDKILV NRWHSRGNMM GEDANLWEQL QSLKDFSAIE DLEGICPNSG SLLPSSECMY  240
SDGVYFRDSQ DDFTIDLWGN WS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-27191217108B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.I00828.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010030549.10.0PREDICTED: transcription factor MYB23-like
TrEMBLA0A059AM790.0A0A059AM79_EUCGR; Uncharacterized protein
STRINGPOPTR_0019s14140.13e-51(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.18e-42myb domain protein 15